Skip to content

THGLab/IDPForge

Repository files navigation

IDPForge (Intrinsically Disordered Protein, FOlded and disordered Region GEnerator)

A transformer protein language diffusion model to create all-atom IDP ensembles and IDR disordered ensembles that maintains the folded domains.

Getting started

To get started, this repository must be cloned using the following command:

git clone https://github.com/THGLab/IDPForge.git

Following that, the working conda environment can be established in two ways.

IDPForge Main Installation Protocol

First, navigate to the new IDPForge directory:

cd IDPForge

The base environment can be built manually via the environment.yml file in the repo. To do this, run the following command:

conda env create -f environment.yml

Once the environment is created, activate it.

conda activate IDPForge

Then install IDPForge as a module in the environment.

pip install -e .

Note: The default file is set to install torch==2.5.1 and cuda==12.1 for earlier GPUs (sm_60 - sm_80). Optionally, this may be changed to install torch==2.7.1 and cuda==12.8 for later generation GPUs (sm_60 - sm_120). Refer to the comments in the file for modification instructions.

This repo also requires OpenFold utilities, so that repository must be cloned in the same directory as IDPForge. To do this, first navigate to the parent directory.

cd ../

Then clone the OpenFold repository into the parent directory.

git clone https://github.com/aqlaboratory/openfold.git

Once the repository is cloned, proceed into the resources of OpenFold.

cd openfold/openfold/resources

In there, download the following file.

wget https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt

Once this is done, navigate back into the main OpenFold directory.

cd ../../

The OpenFold setup must be replaced. To do this, first locate the 2 setup replacements provided with the IDPForge repository.

ls path/to/my/IDPForge/dockerfiles/openfold_setup_12*

Note: The output should look like the following: path/to/my/IDPForge/dockerfiles/openfold_setup_12.1.py path/to/my/IDPForge/dockerfiles/openfold_setup_12.8.py

Then copy openfold_setup_12.1.py into the OpenFold directory as the new setup.py.

cp path/to/my/IDPForge/dockerfiles/openfold_setup_12.1.py path/to/my/openfold/setup.py

Note: If the alternative installation was chosen in Step 3, copy the openfold_setup_12.8.py version instead.

Finally, install OpenFold as a module in the environment.

pip install -e .

This makes the environment fully ready for use.

Alternative Installation for Compute Cluster

If you have issues setting up the base environment from the yml file, or if you are setting IDPForge up for use on an HPC cluster, it is recommended to follow the installation by openfold. To do this, start by cloning both repositories in the same directory.

git clone https://github.com/THGLab/IDPForge.git
git clone https://github.com/aqlaboratory/openfold.git

Then navigate into the OpenFold directory.

cd openfold/

Create the OpenFold environment using the following command.

mamba env create -n openfold_env -f environment.yml

Note: This can also be run with conda env create -n openfold_env -f environment.yml

Then activate the environment.

conda activate openfold_env

Install other dependencies required by IDPForge using the following commands:

conda install einops mdtraj pdb-tools -c conda-forge
conda install mmseqs2 -c bioconda
pip install tensorboard topoly

It is also recommended to uninstall flash-attn when starting out if this installation pathway is chosen.

pip uninstall flash-attn

Once flash-attn is uninstalled, navigate into the resources of Openfold.

cd openfold/resources

In there, download the following file.

wget https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt

Navigate back to the main directory of OpenFold.

cd ../../

Install OpenFold as a module in the environment.

pip install -e .

Note: If pip install -e . does not work, proceed with pip install . --no-build-isolation instead.

Navigate to the IDPForge directory.

cd ../IDPForge

Install IDPForge as a module.

pip install -e .

Note: If pip install -e . does not work, proceed with pip install . --no-build-isolation instead.

This makes the environment fully ready for use.

Note: For more information on OpenFold installation, please refer to the installation guide. https://openfold.readthedocs.io/en/latest/Installation.html

Downloading model weights and other files

Models weights, example training data, and other inference input files can be downloaded from Figshare.

It is recommended to copy the weights/ directory directly into the IDPForge repository as IDPForge/weights/. Similarly, the contents of data/ can be copied into the given IDPForge/data/ directory.

Notes on ESM2 and Attention

ESM2 utilities are refactored into this repo for network modules and exploring the effects of ESM embedding on IDP modeling. Alternatively, it can be installed from their github https://github.com/facebookresearch/esm.git, or via pip install pip install fair-esm.

Optional: pip install flash-attn==2.3 to speed up attention calculation.

Using Docker

IDPForge can also be built as a docker container using either of the included dockerfiles (Blackwell or Ampere). Blackwell runs on CUDA12.8 and Ampere runs on CUDA12.1. Optionally, the training weights and data files from Figshare may be merged before the creation of the image. This will ensure the image contains the merged files, removing the need for additional /weights and /data mounting.

To build the image, run the following command from the root of this repository choosing either Blackwell or Ampere based on preference:

docker build -f dockerfiles/Dockerfile_[Blackwell/Ampere] -t idpforge:latest .

To confirm that your idpforge:latest image is successfully completed, run

docker images

To run a container from the newly created image, run

docker run --rm -it --gpus all idpforge:latest

To verify that your docker installation is able to properly communicate with your GPU, run

docker run --rm --gpus all nvidia/cuda:12.8.1-base-ubuntu22.04 nvidia-smi

Once the image is created, outside directories can be added into a container by mounting them as follows.

docker run --rm -it --gpus all \
    -v "[path-to-directory]":/app/[directory-name-in-container] \
    # Optional: any other mounts... \
    idpforge:latest

Examples of this are given in later sections.

Training

We use pytorch-lightning for training and one can customize training via the documented flags under trainer in the config file.

conda activate idpforge
python train.py --model_config_path configs/train.yml

Sampling

Sampling loops through three phases until the target is met:

  1. Generate + Relax: Calls sample_ldr.py to produce diffusion conformers, which are immediately relaxed via AMBER minimization (relax config loaded from configs/sample.yml).
  2. Repair: Checks each relaxed structure for D-amino acids (chirality) and broken HIS ring bonds. Applies fixes and re-relaxes if any repairs were made.
  3. Validate: Runs unified validation checking chirality, bond integrity, clash score (adaptive smart threshold), and backbone topology (knot detection). Passing structures are renamed to N_validated.pdb.

With that, sampling scripts are provided for wholly disordered and partially disordered proteins below.

Single chain IDP/IDRs

We provide a commandline interface to sample single chain IDP/IDRs.

usage: sample_idp.py seq ckpt_path output_dir sample_cfg
[-h] [--batch BATCH] [--nconf NCONF] [--cuda] 
[--verbose]$

positional arguments:
  seq                protein sequence
  ckpt_path          path to model weights
  output_dir         directory to output pdbs
  sample_cfg         path to a sampling configuration    
                     yaml file

optional arguments:
  --batch BATCH      batch size 
  --nconf NCONF      number of conformers to sample
  --cuda             whether to use cuda or cpu
  --verbose          show or hide debugging logs

Example to generate 100 conformers for Sic1:

mkdir test
sequence="GSMTPSTPPRSRGTRYLAQPSGNTSSSALMQGQKTPQKPSQNLVPVTPSTTKSFKNAPLLAPPNSNMGMTSPFNGLTSPQRSPFPKSSVKRT"
python sample_idp.py $sequence weights/mdl.ckpt test configs/sample.yml --nconf 100 --cuda --verbose

Inference time experimental guidance can be activated by the potential flag in the configs/sample.yml. An example PREs experimental data file is also provided in data/sic1_pre_exp.txt.

This can also be run within the previously created docker image. Set the working directory to the root of the previously cloned and merged version of this repository and run the following.

mkdir test
sequence="GSMTPSTPPRSRGTRYLAQPSGNTSSSALMQGQKTPQKPSQNLVPVTPSTTKSFKNAPLLAPPNSNMGMTSPFNGLTSPQRSPFPKSSVKRT"
docker run -it --rm --gpus all \
    -v "./test/":/app/output \
    -v "./data/":/app/data \
    -v "./weights/":/app/weights \
    -w /app \
    idpforge:latest \
    python -u /app/sample_idp.py $sequence /app/weights/mdl.ckpt /app/output /app/configs/sample.yml --nconf 100 --cuda --verbose

IDRs with folded domains

First, to prepare the folded template, run python init_ldr_template.py. We provide an example for sampling the low confidence region of AF entry P05231:

python mk_ldr_template.py data/AF-P05231-F1-model_v4.pdb 1-41 data/AF-P05231_ndr.npz

The provided model weights are not recommended for predicting multiple domains at the same time.

Then, to generate an IDRs with folded domains ensemble, run

mkdir P05231_build
python sample_ldr.py weights/mdl.ckpt data/AF-P05231_ndr.npz P05231_build configs/sample.yml --nconf 100 --cuda --verbose

One can set the attention_chunk to manage memory usage for long sequences (Inference on long disordered sequences may be limited by training sequence length).

This can also be run within the previously created docker image. Set the working directory to the root of the previously cloned and merged version of this repository and run the following.

mkdir P05231_build
docker run -it --rm --gpus all \
    -v "./P05231_build/":/app/output \
    -v "./data/":/app/data \
    -v "./weights/":/app/weights \
    -w /app \
    idpforge:latest \
    python -u /app/sample_ldr.py /app/weights/mdl.ckpt /app/data/AF-P05231_ndr.npz /app/output /app/configs/sample.yml --nconf 100 --cuda --verbose

Chemical shifts prediction and evaluating ensembles with X-EISD (optional)

We use UCBShift for chemical shift prediction and can be installed at https://github.com/THGLab/CSpred.git. If you wish to use X-EISD for evaluation or reweighing with experimental data, please refer to https://github.com/THGLab/X-EISDv2.

Citation

@article {DeCastro2026,
	author = {De Castro, Stefano and Zhang, Oufan and Liu, Zi Hao and Forman-Kay, Julie Deborah and Head-Gordon, Teresa},
	title = {IDPForge: Deep Learning of Proteins with Global and Local Regions of Disorder},
	elocation-id = {2026.03.25.714313},
	year = {2026},
	doi = {10.64898/2026.03.25.714313},
	publisher = {Cold Spring Harbor Laboratory},
	URL = {https://www.biorxiv.org/content/early/2026/03/27/2026.03.25.714313},
	eprint = {https://www.biorxiv.org/content/early/2026/03/27/2026.03.25.714313.full.pdf},
	journal = {bioRxiv}
}

About

Disordered protein ensemble prediction

Resources

License

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors

Languages