Skip to content

Andrew-Leduc/AAS_Evo

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

144 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

AAS_Evo

Multi-omics data pipeline for CPTAC3 (Clinical Proteomic Tumor Analysis Consortium). Downloads and processes matched genomics (WXS BAM files from GDC) and proteomics (TMT-labeled RAW files from PDC) data for integrated analysis of amino acid substitutions.

Repository Structure

AAS_Evo/
├── config/
│   └── paths.py                      # Environment-aware path config
├── metadata/                            # Tracked metadata (in-repo)
│   ├── studies.tsv                      # Study registry (tissue → PDC study ID)
│   ├── GDC_meta/                        # GDC manifests & sample metadata
│   │   └── manifests/manifest_wxs_bams.tsv
│   ├── PDC_meta/                        # PDC per-tissue CSVs & consolidated files
│   │   ├── {tissue}/PDC_file_manifest.csv
│   │   ├── {tissue}/PDC_study_biospecimen.csv
│   │   └── {tissue}/PDC_study_experimental.csv
│   └── mapping_report.tsv              # GDC↔PDC matching report
├── scripts/
│   ├── setup/
│   │   ├── setup_metadata.sh            # Orchestrator: fetch all metadata from APIs
│   │   ├── setup_seq_files.sh           # Download all external reference files
│   │   ├── fetch_gdc_manifest.py        # Query GDC REST API for WXS BAM manifest
│   │   └── fetch_pdc_metadata.py        # Query PDC GraphQL API for per-tissue metadata
│   ├── download/
│   │   ├── gdc/
│   │   │   ├── submit_download.sh       # Submit SLURM download jobs
│   │   │   ├── download_chunk.sh        # Single-chunk SLURM download job
│   │   │   ├── download.py              # GDC download via gdc-client
│   │   │   ├── fetch_metadata.py        # Fetch sample metadata from GDC API
│   │   │   ├── fetch_unmatched_bams.py  # Find WXS BAMs for unmatched PDC patients
│   │   │   └── setup_chunks.sh          # Split manifest into chunks
│   │   ├── pdc/
│   │   │   ├── submit_download.sh       # SLURM job wrapper
│   │   │   ├── download.py              # PDC download (rate-limited)
│   │   │   ├── refresh_urls.py          # Refresh expired PDC signed URLs via API
│   │   │   └── consolidate_metadata.py  # Merge per-tissue CSVs
│   │   └── mapping_report.py            # GDC-PDC sample matching
│   ├── proc_bams/
│   │   ├── run_pipeline.sh              # Wrapper: auto-generates file lists + submits jobs
│   │   ├── submit_variant_call.sh       # SLURM array: variant calling
│   │   ├── submit_vep.sh               # SLURM array: VEP annotation + AlphaMissense
│   │   └── consolidate_missense.sh      # Merge missense mutations
│   ├── mutation_analysis/               # Filtering, MSA generation & coevolution
│   │   ├── filter_and_rank.py
│   │   ├── generate_msas.py
│   │   ├── submit_msa_generation.sh
│   │   ├── coevolution_analysis.py
│   │   └── submit_coevolution.sh
│   ├── fasta_gen/                       # Custom proteogenomics FASTAs
│   │   ├── generate_mutant_fastas.py
│   │   ├── combine_plex_fastas.py
│   │   ├── generate_compensatory_fastas.py
│   │   ├── submit_compensatory_fastas.sh
│   │   └── submit_proteogenomics.sh
│   └── ms_search/                       # FragPipe MS database search
│       └── fragpipe/
│           ├── run_ms_search.sh         # Orchestrator: setup + submit SLURM array
│           ├── generate_manifests.py    # Generate per-plex manifests + patch workflows
│           ├── add_decoys.py            # Append rev_ decoy sequences to FASTAs
│           ├── submit_fragpipe.sh       # SLURM array job (one plex per task)
│           └── validation.ipynb        # Channel enrichment validation notebook
└── .claude/
    └── CLAUDE.md                        # Detailed project context

Cluster Data Layout

/scratch/leduc.an/AAS_Evo/
├── BAMS/              # GDC BAM files (by UUID subdirectory)
├── RAW/               # PDC RAW files (flattened)
├── VCF/               # Variant calls (per-chunk subdirectories)
│   ├── chunk_00/      # VCFs from first BAM chunk
│   └── chunk_01/ ...
├── VEP/               # VEP annotations (per-chunk subdirectories)
│   ├── chunk_00/      # VEP output from first chunk
│   ├── chunk_01/ ...
│   └── all_missense_mutations.tsv  # Consolidated (top-level)
├── SEQ_FILES/         # Reference files
│   ├── hg38.fa        # Human reference genome (GRCh38)
│   ├── cds.chr.bed    # CDS regions for targeted variant calling
│   ├── uniprot_human_canonical.fasta  # UniProt reviewed proteome
│   ├── uniref50       # MMseqs2 UniRef50 database
│   └── AlphaMissense_hg38.tsv.gz     # AlphaMissense pathogenicity data
├── ANALYSIS/          # Mutation filtering & ranking output
├── FASTA/             # Custom proteogenomics FASTAs
│   ├── per_sample/    # Per-sample mutant entries
│   ├── per_plex/      # Reference + plex-specific mutants + compensatory
│   └── compensatory/  # Predicted compensatory mutation entries
├── MSA/               # Per-gene multiple sequence alignments (A3M)
├── COEVOL/            # Coevolution analysis output
├── MS_SEARCH/         # FragPipe MS search setup & results
│   ├── manifests/     # Per-plex .fp-manifest files
│   ├── annotations/   # Per-plex TMT channel annotations
│   └── results/       # Per-plex FragPipe output
└── logs/              # SLURM job logs

Pipeline Overview

Download BAMs → Variant Call → VEP (+ AlphaMissense) → Consolidate
    ↓                                                       ↓
    ↓                                           All Missense Mutations
    ↓                                                       ↓
Filter & Rank (top 5000)                      Per-Sample Mutant FASTAs
    ↓                                                       ↓
Generate MSAs (MMseqs2)                                     ↓
    ↓                                                       ↓
Coevolution Analysis                                        ↓
    ↓                                                       ↓
Compensatory FASTAs ─────────────────────────────────────→  ↓
                                                            ↓
                              Combine Per-Plex FASTAs (ref + observed + compensatory)
                                                            ↓
                                              FragPipe MS Search (per plex)

Workflows

0. Metadata Setup (One-Time)

Fetches all metadata from GDC and PDC APIs programmatically. No manual portal downloads needed.

bash scripts/setup/setup_metadata.sh

This runs six steps automatically:

  1. GDC manifest — queries GDC REST API for all CPTAC WXS BAM files (projects from studies.tsv)
  2. GDC metadata — enriches manifest with case/sample info
  3. PDC metadata — queries PDC GraphQL API for file manifests, biospecimen data, and TMT plex layouts (all 12 tissues)
  4. Consolidate — merges per-tissue PDC CSVs into unified files
  5. Matching — cross-references GDC↔PDC samples, generates pruned manifests
  6. Recover unmatched — finds WXS BAMs for PDC patients missing from the initial GDC manifest, merges them in, and re-runs matching

To add a new tissue/study, add a row to metadata/studies.tsv and re-run.

GDC token: BAM downloads require dbGaP authorization. Download your token from the GDC portal (username → Download Token) and pass the file path to submit_download.sh. The token is NOT needed for this metadata setup step.

1. Reference File Setup (One-Time)

Downloads and indexes all external reference files (~100 GB total):

# As SLURM job (recommended for large downloads):
sbatch scripts/setup/setup_seq_files.sh

# Or skip large files (UniRef90, VEP) for initial testing:
bash scripts/setup/setup_seq_files.sh --skip-large

Downloads: hg38 genome, GENCODE CDS regions, UniProt canonical proteome, AlphaMissense data, UniRef90 database, and VEP container + cache.

2. Data Download (Chunked)

BAMs are downloaded in chunks of ~400 to stay within storage limits:

# One-time: split manifest into chunks (400 BAMs each, tissue-only)
bash scripts/download/gdc/setup_chunks.sh 400 path/to/manifest_wxs_bams_tissue.tsv

# Per chunk (repeat for each chunk manifest):
bash scripts/download/gdc/submit_download.sh path/to/chunks/chunk_00.tsv

PDC RAW files (open access):

sbatch scripts/download/pdc/submit_download.sh

3. BAM Processing Pipeline

Processes all BAMs currently in BAMS/, outputs to per-chunk subdirectories (VCF/chunk_00/, VEP/chunk_00/):

# Step 1: Variant calling (finds BAMs automatically, outputs to VCF/chunk_00/)
bash scripts/proc_bams/run_pipeline.sh variant-call chunk_00

# Step 2: VEP annotation with AlphaMissense (reads VCF/chunk_00/, outputs to VEP/chunk_00/)
bash scripts/proc_bams/run_pipeline.sh vep chunk_00

# Step 3: Delete BAMs, download next chunk, repeat with chunk_01, etc.
rm -rf /scratch/leduc.an/AAS_Evo/BAMS/*

VCF/VEP outputs persist across chunks in their subdirectories. Both scripts skip already-processed samples.

Final output (all_missense_mutations.tsv, 18 columns): sample_id, genomic position, consequence, gene symbol, protein change (HGVSp), amino acid swap, gnomADe_AF, AlphaMissense pathogenicity + class, read depths, VAF.

4. Consolidate & Filter Mutations

# After ALL chunks are processed: merge per-sample VEP TSVs
bash scripts/proc_bams/consolidate_missense.sh

# Rank mutations by composite pathogenicity score (AlphaMissense, gnomAD, recurrence)
python3 scripts/mutation_analysis/filter_and_rank.py \
    --vep-tsv /scratch/leduc.an/AAS_Evo/VEP/all_missense_mutations.tsv \
    --ref-fasta /scratch/leduc.an/AAS_Evo/SEQ_FILES/uniprot_human_canonical.fasta \
    -o /scratch/leduc.an/AAS_Evo/ANALYSIS

Output: ANALYSIS/top_5000_mutations.tsv, ANALYSIS/gene_list_for_msa.txt (used automatically by downstream steps).

5. MSA Generation

# Submit MSA generation (auto-finds gene list from ANALYSIS/)
NUM_GENES=$(wc -l < /scratch/leduc.an/AAS_Evo/ANALYSIS/gene_list_for_msa.txt)
sbatch --array=1-${NUM_GENES}%10 scripts/mutation_analysis/submit_msa_generation.sh

MSA files named by UniProt accession (P04637.a3m). Pre-existing MSAs are auto-detected and skipped.

6. Coevolution Analysis

Predicts compensatory translation errors using EVcouplings/Direct Coupling Analysis (DCA). Given a destabilizing missense mutation at position i, uses the Potts model coupling tensor J(i,a;j,b) to identify covarying positions and predict which amino acid substitution could compensate.

Method: Mean-field DCA computes evolutionary couplings between all position pairs. The coupling parameters directly encode which amino acid combinations are evolutionarily preferred, enabling more accurate compensatory predictions than simple mutual information.

# After MSA generation completes (auto-finds gene list from ANALYSIS/):
sbatch scripts/mutation_analysis/submit_coevolution.sh

Output: COEVOL/compensatory_predictions.tsv

7. Generate Compensatory FASTAs

# After coevolution analysis completes:
sbatch scripts/fasta_gen/submit_compensatory_fastas.sh

Output: FASTA/compensatory/all_compensatory.fasta — tryptic peptides containing both the original destabilizing mutation and the predicted compensatory substitution.

8. Proteogenomics FASTA Generation

# Generate per-sample mutant FASTAs + per-plex search databases
# Automatically includes compensatory entries if FASTA/compensatory/ exists
sbatch scripts/fasta_gen/submit_proteogenomics.sh

Creates custom MS search databases per TMT plex: reference proteome + plex-specific mutant tryptic peptides + plex-specific compensatory peptides.

Tryptic peptide approach: Instead of adding full mutant proteins (~500 AA each), the pipeline extracts only tryptic peptides containing mutations (~15 AA avg). This minimizes database size and improves FDR statistics.

FASTA headers — two formats exist at different stages:

Per-sample FASTAs (FASTA/per_sample/) use a simple internal format:

>mut|P04637|TP53|R273H|genetic
SVTCTYSPALNKMFCQLAK

Per-plex FASTAs (FASTA/per_plex/) are rebuilt by combine_plex_fastas.py into a Philosopher-compatible mock-UniProt format required for FragPipe:

>sp|P04637-R273H-A3F2|TP53-mut TP53 mutant R273H OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=1
>sp|P04637-comp-R273H-G245S-A3F2|TP53-comp TP53 compensatory R273H_G245S OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=1

The accession field structure is {UniProtID}-{swap}-{4-char-seq-hash}. The hash disambiguates multiple tryptic peptides for the same mutation (different missed cleavage contexts). See the FASTA structure section below for why this format is required.

9. MS Database Search (FragPipe)

FragPipe is the primary tool for the MS database search. Each TMT plex is searched independently against its own custom FASTA (reference + plex-specific mutant peptides + compensatory peptides).

FragPipe Installation

FragPipe requires several components to be installed together. The pipeline was developed and validated with FragPipe 24.0.

Required components (all managed via the FragPipe GUI on first install):

  • FragPipe 24.0 — main orchestrator (fragpipe-24.0/bin/fragpipe)
  • MSFragger — database search engine (bundled with FragPipe)
  • Philosopher — statistical validation and reporting (bundled with FragPipe)
  • IonQuant / TMT-Integrator — TMT reporter ion quantification (bundled with FragPipe)
  • Java 17 — required runtime (jdk-17.0.18+8 used here; set JAVA_HOME)

Note: The exact versions of MSFragger, Philosopher, and IonQuant bundled with FragPipe 24.0 should be noted here — check the FragPipe GUI's Tools tab for what was actually used.

Installation paths are configured in submit_fragpipe.sh:

FRAGPIPE_BIN=/home/leduc.an/bin/fragpipe-24.0/bin/fragpipe
FRAGPIPE_TOOLS=/home/leduc.an/bin/fragpipe-24.0/tools
JAVA_HOME=/home/leduc.an/bin/jdk-17.0.18+8

FASTA Database Structure

FragPipe requires decoy sequences in the search database (target-decoy FDR estimation). The pipeline maintains two separate copies of the per-plex FASTAs:

  • FASTA/per_plex/ — clean FASTAs, no decoys (used by MaxQuant if needed)
  • FASTA/per_plex_fragpipe/ — FASTAs with reversed decoy entries appended (rev_ prefix)

run_ms_search.sh runs add_decoys.py automatically to generate the FragPipe copies. Decoys are full sequence reversals (not shuffled), prefixed with rev_. FragPipe detects decoys by this prefix.

The per-plex FASTA contains four entry types:

# Standard reference proteins (passed through from UniProt)
>sp|P04637|P53_HUMAN Cellular tumor antigen p53 ... GN=TP53 PE=1 SV=4
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDP...

# Observed mutant tryptic peptides (Philosopher-compatible mock-UniProt format)
>sp|P04637-R273H-A3F2|TP53-mut TP53 mutant R273H OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=1
SVTCTYSPALNKMFCQLAK

# Compensatory mutation peptides
>sp|P04637-comp-R273H-G245S-A3F2|TP53-comp TP53 compensatory R273H_G245S OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=1
VVRCPHHERCSDSDGLAPPQHLIRVEGNLHAEYLDDQQFIFHSVVVPYEPPEVGSDCTTIHYNYMCNS

# Reversed decoys (appended by add_decoys.py)
>rev_sp|P04637|P53_HUMAN ...

Why this specific header format: Philosopher classifies FASTA entries by accession format during philosopher database --annotate. Entries with non-UniProt accessions (e.g. MUT_P04637_R273H) are classified as "generic" proteins and skipped — they never appear in db.bin, causing the filter step to crash with "protein not in database" errors. Using the real UniProt accession as the base (P04637-R273H-HASH) causes Philosopher to classify the entry as a UniProt variant, store it in db.bin, and handle it correctly throughout the pipeline. The GN= field is separately required by TMT-Integrator for gene-level intensity reports. Underscores in the accession field also break Philosopher's parser, which is why compensatory swap combos use dashes (R273H-G245S) not underscores in the accession field.

Mutant and compensatory entries are single tryptic peptides (~15 AA avg), not full proteins. Any mutant peptide that is a substring of its parent reference protein is filtered out at this stage — MSFragger matches by sequence, so a shared substring would assign the PSM to the reference entry and cause Philosopher to crash looking up the mutant accession.

Workflow Configuration

The FragPipe workflow is a .workflow file exported from the FragPipe GUI. Key settings used:

  • Search type: TMT-11 closed search
  • TMT channels: 11-plex (126–131C); forced via tmtintegrator.channel_num=TMT-11 patch in generate_manifests.py
  • Decoy prefix: rev_ (must match what add_decoys.py uses)
  • Protein FDR: default template value (standard --prot 0.05)

Note: The specific search parameters in the workflow (precursor/fragment mass tolerances, variable modifications, enzyme, missed cleavages, etc.) are set in the .workflow file on the cluster. These should be documented here once confirmed — export the workflow from the FragPipe GUI and check the MSFragger section.

To create the workflow:

  1. Open FragPipe GUI on a machine with the RAW files accessible (or use a test file)
  2. Load files → select TMT-11 experiment type
  3. Configure MSFragger search parameters for closed search
  4. Enable Philosopher (PeptideProphet, ProteinProphet) and TMT-Integrator
  5. Export workflow → save as fragpipe.workflow
  6. Copy to the cluster and pass to run_ms_search.sh

Running the Search

# Step 1: Set up per-plex manifests + copy FASTAs with decoys + submit jobs
bash scripts/ms_search/fragpipe/run_ms_search.sh /path/to/template.workflow

# Or: generate manifests first, add workflow manually, then submit
bash scripts/ms_search/fragpipe/run_ms_search.sh
# -> place workflow at MS_SEARCH/fragpipe.workflow, then:
NUM_PLEXES=$(wc -l < /scratch/leduc.an/AAS_Evo/MS_SEARCH/plex_list.txt)
sbatch --array=1-${NUM_PLEXES}%5 scripts/ms_search/fragpipe/submit_fragpipe.sh

run_ms_search.sh does three things automatically:

  1. Copies per-plex FASTAs to FASTA/per_plex_fragpipe/ with rev_ decoys appended
  2. Generates per-plex .fp-manifest files and TMT channel annotation files
  3. Patches per-plex workflow files with the correct FASTA path and TMT-11 channel count

Each SLURM job: 16 CPUs, 64 GB RAM, 24h time limit, 5 plexes concurrent.

Output

Results are written to MS_SEARCH/results/{plex_id}/. Key output files:

  • {plex_id}_1/psm.tsv — PSM-level results with TMT reporter intensities
  • combined_protein.tsv — protein-level summary (Philosopher)
  • experiment_annotation.tsv — TMT channel → patient ID mapping (copied from annotations/)

Search completion is detected by the presence of combined_protein.tsv. Re-submitting the array job safely skips completed plexes.

Reference Files

All reference files are downloaded and indexed by scripts/setup/setup_seq_files.sh. They live in /scratch/leduc.an/AAS_Evo/SEQ_FILES/:

File Source Size
hg38.fa + .fai UCSC Genome Browser (chr-prefix, matching GDC BAMs) ~3 GB
cds.chr.bed GENCODE v46 CDS regions (merged, standard chromosomes) ~2 MB
uniprot_human_canonical.fasta UniProt reference proteome UP000005640 (reviewed, canonical) ~25 MB
AlphaMissense_hg38.tsv.gz + .tbi DeepMind AlphaMissense pathogenicity predictions ~6 GB
uniref50 (MMseqs2 db) UniProt Reference Clusters at 50% identity ~60 GB
VEP container + cache Ensembl VEP Apptainer image ~15 GB

Requirements

Genomics pipeline:

  • Python 3.8+, pandas, numpy
  • gdc-client (GDC Data Transfer Tool, for controlled-access BAM downloads)
  • samtools, bcftools (variant calling)
  • bedtools (for generating CDS BED from GENCODE annotation)
  • htslib / tabix (AlphaMissense indexing)
  • Ensembl VEP via Apptainer container (annotation + AlphaMissense plugin)

Coevolution pipeline:

  • mmseqs2 (MSA generation against UniRef50)

MS search pipeline:

  • FragPipe 24.0 with bundled MSFragger, Philosopher, and IonQuant/TMT-Integrator
  • Java 17 (required by FragPipe/MSFragger)
  • Workflow file configured for TMT-11 closed search (exported from FragPipe GUI)

Data Sources

Source Data Type Access Files
GDC WXS BAM files Controlled (dbGaP) ~2,098 matched
PDC TMT RAW files Open (signed URLs) ~5,020 matched

License

MIT License

About

Do translation errors aid protein evolution

Resources

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors